PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009615565.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 557aa    MW: 62096.9 Da    PI: 8.7214
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009615565.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.23.5e-33223280260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     +DgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkver+  d++++ei+Y+g+Hnh+k
  XP_009615565.1 223 EDGYNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERNL-DGHITEIVYKGNHNHPK 280
                     8****************************************.***************85 PP

2WRKY1061.9e-33387445159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+Ct++gCpv+k+ver+++d ++v++tYeg+Hnh+
  XP_009615565.1 387 LDDGYRWRKYGQKVVKGNPNPRSYYKCTFTGCPVRKHVERASHDLRAVITTYEGKHNHD 445
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.5E-27217281IPR003657WRKY domain
PROSITE profilePS5081123.456217281IPR003657WRKY domain
SuperFamilySSF1182901.16E-24218281IPR003657WRKY domain
SMARTSM007742.1E-35222280IPR003657WRKY domain
PfamPF031069.0E-25223279IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.6E-37372447IPR003657WRKY domain
SuperFamilySSF1182902.48E-29379447IPR003657WRKY domain
PROSITE profilePS5081138.067382447IPR003657WRKY domain
SMARTSM007744.3E-39387446IPR003657WRKY domain
PfamPF031068.8E-26388445IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0010120Biological Processcamalexin biosynthetic process
GO:0010200Biological Processresponse to chitin
GO:0010508Biological Processpositive regulation of autophagy
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MASSGGNMNT FMNSFTSNYS FSSFSDLLSE NDNNNMRSNN SSMNQEKNSL NWGFSDQRMN  60
QQNKDEVPKF KSFPPSSLPM ISSSSPASPS SYLAFPPSLS PSVLLDSPVL FNNSNTLPSP  120
TTGSFGNLNS KEDNSRISDF SFQSKAATSS SMFQSSAPRN SLEDLMTRQQ HANQQNEFST  180
VKTRGVKSEV APIQSFSQEK MQSNPAPVHY THPSQYVREQ KAEDGYNWRK YGQKQVKGSE  240
NPRSYYKCTF PNCPTKKKVE RNLDGHITEI VYKGNHNHPK PQSTRRSSSQ SIQNLAYSNL  300
DITNQSNAFL DNAQRDSFAG TDNSSASFGD EDIDQGSPIS KSGEDDGNEP EPKRWKGDNE  360
NEVISSASRT VREPRIVVQT TSDIDILDDG YRWRKYGQKV VKGNPNPRSY YKCTFTGCPV  420
RKHVERASHD LRAVITTYEG KHNHDVPAAR GSGSYAMNKP PSGNSNNSMP VVPRPSMLAN  480
NSNQGMNFND TFFNTRVQTT QNQPPITLQM LQSSGNSSYS GFDTSSGSYM NQMQPMNNIK  540
PISKEEPKDD FFSSFLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-34223448878Probable WRKY transcription factor 4
2lex_A9e-34223448878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00299DAPTransfer from AT2G38470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0226930.0AB022693.1 Nicotiana tabacum mRNA for NtWRKY1, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009615565.10.0PREDICTED: probable WRKY transcription factor 26 isoform X2
RefseqXP_016482656.10.0PREDICTED: probable WRKY transcription factor 26 isoform X2
SwissprotQ8S8P51e-125WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLD2KU320.0D2KU32_NICBE; Double WRKY type transfactor
STRINGSolyc09g014990.2.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-119WRKY DNA-binding protein 33